Protein coding transcript 43733

• Transcript: Ll_transcript_360220
• CDS coordinates: 145-1083 (+)
• Peptide sequence: MASLSYTFSKMPPITFTFTFIFMLMLFLGVFTPLGYSAPTTHLAGSAQLKVSPSQFVGLVTQVLDVLKQVSSILSKFSSGLGDSRLSHAIYDCLELLDLSSDELTWSQSATQAPKGKHNSTGDLSSDLRTWLSAVLANPETCLEGFEGTNSIVKGLVSAGLGQVTSLVKQLLTQVHPTTEDYHFNKDQFPSWIKPRDRNLIQSNGVAVDAVVAIDGSGNYTNVMDAVLAAPDYSMKRYVIYIKKGVYNEYVEIKKKKWNIMIIGDGIDATVISGNRSFIDGWTTFRSATFGKTMLLFLYLFFSDSSYPTIKF*
• ORF Type: complete

Annotations of Ll_transcript_360220

• Blastp: Pectinesterase/pectinesterase inhibitor PPE8B from Prunus with 64.53% of identity
• Blastx: Pectinesterase/pectinesterase inhibitor PPE8B from Prunus with 65.13% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455433.1)
• Pfam: Plant invertase/pectin methylesterase inhibitor (PF04043.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;