Protein coding transcript 43839

• Transcript: Ll_transcript_359270
• CDS coordinates: 1124-1930 (+)
• Peptide sequence: MDIQASKEFLAELKVLTHVHHLNLVRLIGYGIESSLCLVYEFIENGNLSQHLHGSGREPLPWPIRVQIALDSARGLEYIHEHTMPVYIHRDIKSANILIDKNFRGKVADFGLAKLAEVGSSLHPTGRLVGTFGYMAPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIIQLMGDSKGLVDLFEEVLSQTNSIEDLCKLVDPRLGDNYPIDSVLKLAQLAKACTQYNPQLRPSMRSIVVALMTISSTTDDWDVGSFYKNKKLMNLMSGK*
• ORF Type: complete

Annotations of Ll_transcript_359270

• Blastp: Chitin elicitor receptor kinase 1 from Oryza sativa with 75% of identity
• Blastx: LysM domain receptor-like kinase 3 from Medicago with 74.1% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455825.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;