Transcript | Ll_transcript_359276 |
---|---|
CDS coordinates | 84-746 (+) |
Peptide sequence | MEPIFLFFIKLSPLFFLCSNAESKCTQGCPTALASYYMFNGSDLTYISQIMSSYLLHSPEDIVSYNKDTITNKDKVEAFTRVNVPFPCECIEGEFLGHRFQYVVQKGDTYETVAGTNYANLINVEWLMRFNTYPADSIPSTGILNVTVNCSCGNSDVSDYELFITYPLRPGETLGSVASSVKLDSGLLQRYNPSVNFNQGSGLVYIPGKDQNGSYVFFEF* |
ORF Type | complete |
Blastp | LysM domain receptor-like kinase 3 from Medicago with 49.77% of identity |
---|---|
Blastx | LysM domain receptor-like kinase 3 from Medicago with 49.77% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (MTR_5g086130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455827.1) |
Pfam | LysM domain (PF01476.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer