Protein coding transcript 43846

• Transcript: Ll_transcript_359251
• CDS coordinates: 1049-1795 (+)
• Peptide sequence: METLEFLHINMNSYILCCVCLQLLLALKVRLIGYSIEGSLFLVYEFIENGNLSQHLRGSGRDPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNFRGKVADFGLTKLTEVGGSSLPTARLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIIQANESIADSKGLVALFEGVFNQPDPTEDLCKVVDPRLGDNYPIDSVRKLAQLAKACTHDNPQLRPSMRSIVVALMT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_359251

• Blastp: Chitin elicitor receptor kinase 1 from Oryza sativa with 79.28% of identity
• Blastx: Chitin elicitor receptor kinase 1 from Oryza sativa with 79.28% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425563.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;