Protein coding transcript 43848

• Transcript: Ll_transcript_359253
• CDS coordinates: 1336-2247 (+)
• Peptide sequence: MANKIGQGGFGVVYYAELRGEKAAIKKMDMQASKEFLAELKVLTHVHHLNLVRLIGYSIEGSLFLVYEFIENGNLSQHLRGSGRDPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNFRGKVADFGLTKLTEVGGSSLPTARLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIIQANESIADSKGLVALVNLYFSTYIIFKSTIIVVLISFYYVLQFEGVFNQPDPTEDLCKVVDPRLGDNYPIDSVRKVRTFVRLNLFLYANCLGLNPGSRSFMSRNSTN*
• ORF Type: complete

Annotations of Ll_transcript_359253

• Blastp: Chitin elicitor receptor kinase 1 from Oryza sativa with 72.04% of identity
• Blastx: Chitin elicitor receptor kinase 1 from Oryza sativa with 66.76% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425563.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;