Protein coding transcript 43849

• Transcript: Ll_transcript_359255
• CDS coordinates: 1049-1426 (+)
• Peptide sequence: METLEFLHINMNSYILCCVCLQLLLALKVRLIGYSIEGSLFLVYEFIENGNLSQHLRGSGRDPLPWPTRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNFRGKVRYVLRSLFLISGLL*
• ORF Type: complete

Annotations of Ll_transcript_359255

• Blastp: Chitin elicitor receptor kinase 1 from Arabidopsis with 84.34% of identity
• Blastx: Chitin elicitor receptor kinase 1 from Oryza sativa with 67.91% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G21630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425563.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;