Transcript | Ll_transcript_360920 |
---|---|
CDS coordinates | 121-924 (+) |
Peptide sequence | MLTHIGSCFLKPPPLSAAPISHSRFQNTKLLRVNCSYSSFEVRDVSYQPPGTPLKLLNSVSFSLPDKSLGLIFGQSGSGKTTLLQLLAGINKPTSGSICTQKYGNDGNPSQPPEPLVPERVGIVFQFPERYFVADSVLDEVTFGWPRQKDSYQLRENLAQGLQRAINWVGLSGIPLDKNPHSLSGGYKRRLALAIQLVQIPDLLILDEPLAGLDWKARADVVKLLMNLKKELTVLVVSHDLREFKSLVDRSWRMEMGGYLREELLQF* |
ORF Type | complete |
Blastp | ABC transporter I family member 11, chloroplastic from Arabidopsis with 74.27% of identity |
---|---|
Blastx | ABC transporter I family member 11, chloroplastic from Arabidopsis with 74.27% of identity |
Eggnog | ATPase activity(COG1122) |
Kegg | Link to kegg annotations (AT5G14100) |
CantataDB | Link to cantataDB annotations (CNT0001897) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429672.1) |
Pfam | ABC transporter (PF00005.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer