Transcript | Ll_transcript_360941 |
---|---|
CDS coordinates | 808-1233 (+) |
Peptide sequence | MDVGSSDKWAKAPSCNWSAIPPPELRGETLEDLSTNGGFVTFDISSRHIEGKRLDKTVWNLLNFNAYVRYHVKSTKGYIQRRMRKRLENLVQVLHHTNSEANEQTKQHQGLLSPNTFNIVDNTIDRLRTKLVPEISLIRLC* |
ORF Type | complete |
Blastp | Actin-related protein 2/3 complex subunit 2B from Arabidopsis with 43.94% of identity |
---|---|
Blastx | Actin-related protein 2/3 complex subunit 2B from Arabidopsis with 61.31% of identity |
Eggnog | protein 2 3 complex subunit(ENOG410YKF6) |
Kegg | Link to kegg annotations (AT2G33385) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429505.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer