Protein coding transcript 43876

• Transcript: Ll_transcript_360936
• CDS coordinates: 808-1326 (+)
• Peptide sequence: MDVGSSDKWAKAPSCNWSAIPPPELRGETLEDLSTNGGFVTFDISSRHIEGKRLDKTVWNLLNFNAYVRYHVKSTKGYIQRRMRKRLENLVQVLHHTNSEANEQTKQHQAAGYRHAKKQLRSSKYNIMKQRWGNFGRKIKTHFRLRIHGFGRFRQRWLRFPKFSSKGYAKLE*
• ORF Type: complete

Annotations of Ll_transcript_360936

• Blastp: Actin-related protein 2/3 complex subunit 2B from Arabidopsis with 43.94% of identity
• Blastx: Actin-related protein 2/3 complex subunit 2B from Arabidopsis with 53.37% of identity
• Eggnog: protein 2 3 complex subunit(ENOG410YKF6)
• Kegg: Link to kegg annotations (AT2G33385)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429504.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;