Protein coding transcript 44097

• Transcript: Ll_transcript_361252
• CDS coordinates: 2-505 (+)
• Peptide sequence: SSSSSSSSSINVYVADLPRSLNYDLLHRYWSLNSDSRLPTDPDSEIRSTHISKTLDFPPYPESPLIKQYSAEYWIMGDLMTPPDLRTGSFSKRVFDARDADVVFVPFFATLSAELQLGMAKGVFRKKVGNDDYLRQREVMDFVKNTQAWKRSGGRDHVFVLTGYLKN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_361252

• Blastp: Probable arabinosyltransferase ARAD1 from Arabidopsis with 26.67% of identity
• Blastx: Probable arabinosyltransferase ARAD1 from Arabidopsis with 42.22% of identity
• Eggnog: Exostosin(ENOG410XTFH)
• Kegg: Link to kegg annotations (AT2G35100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453660.1)
• Pfam: Exostosin family (PF03016.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;