Protein coding transcript 44236

• Transcript: Ll_transcript_374123
• CDS coordinates: 133-666 (+)
• Peptide sequence: MHTPMGVFSPRTSFQNHKGCLRGSRLVSSKNADLNEFPTSETDMVEQLFTARCRVYRRSPNKRANVPIIHLLRGPSLHSLSAVIQLNNYKSGEDSEVFTFKERLHHLQKKEKHIICFGKSGIHGWGLFARRDIQEGEMVVEYRGEQVRRSVADLREAKYRLEGKDCYLFKISEEVVID
• ORF Type: 3prime_partial

Annotations of Ll_transcript_374123

• Blastp: Histone-lysine N-methyltransferase ATX3 from Arabidopsis with 47.69% of identity
• Blastx: Histone-lysine N-methyltransferase ATX3 from Arabidopsis with 48.91% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT3G61740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461947.1)
• Pfam: SET domain (PF00856.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;