| Transcript | Ll_transcript_374369 |
|---|---|
| CDS coordinates | 830-1156 (+) |
| Peptide sequence | MSMLFPVAKLHGPISSELMEMWEMRHHAHEHKKDSQSAPLYEKLRQTLTSELPETGGTLDFESDNDDNRYDTGNPDFDMPGNAYTDEDFPPWNKEVRRGDLYVTIVYS* |
| ORF Type | complete |
| Blastp | Condensin-2 complex subunit H2 from Arabidopsis with 42.31% of identity |
|---|---|
| Blastx | Condensin-2 complex subunit H2 from Arabidopsis with 47.35% of identity |
| Eggnog | non-SMC condensin II complex, subunit H2(ENOG4111BR3) |
| Kegg | Link to kegg annotations (AT3G16730) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419763.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer