Protein coding transcript 44250

• Transcript: Ll_transcript_374370
• CDS coordinates: 1-609 (+)
• Peptide sequence: VLFGIVVSYSYLHYDICLVLFPNNIVELLQLSTTDLYQDFILLDASDAVAVDGFIKGSKTDIAQNAAERPTSARKTFLSPTRCSVGSAHKSSDAKSQRANPNCSPKLNCSYDDNNVHPSSPIFAGDVDDGFDPSRDSDNSDADDPWKPLNPHEPGNLRVKPFRKVKTLKKNRINVTRQVSMSMLFPVAKLHGPISSELMEMWE
• ORF Type: internal

Annotations of Ll_transcript_374370

• Blastp: Condensin-2 complex subunit H2 from Arabidopsis with 46.81% of identity
• Blastx: Condensin-2 complex subunit H2 from Arabidopsis with 46.81% of identity
• Eggnog: non-SMC condensin II complex, subunit H2(ENOG4111BR3)
• Kegg: Link to kegg annotations (AT3G16730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419766.1)
• Pfam: PF16858 (PF16869.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;