Protein coding transcript 44256

• Transcript: Ll_transcript_374364
• CDS coordinates: 830-1198 (+)
• Peptide sequence: MSMLFPVAKLHGPISSELMEMWEMRHHAHEHKKDSQSAPLYEKLRQTLTSELPETGGTLDFESDNDDNRYDTGNPDFDMPGNAYTDEDFPPWNKEHKFDDVHAEASEYPEYPNSQESLEDLCR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_374364

• Blastp: Condensin-2 complex subunit H2 from Arabidopsis with 38.17% of identity
• Blastx: Condensin-2 complex subunit H2 from Arabidopsis with 45.19% of identity
• Eggnog: non-SMC condensin II complex, subunit H2(ENOG4111BR3)
• Kegg: Link to kegg annotations (AT3G16730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419763.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;