Transcript | Ll_transcript_374577 |
---|---|
CDS coordinates | 155-487 (+) |
Peptide sequence | MELEIDDKDLKAAGAEVFVDGGRRGIRIHGWLIETRRNSILNSSSVQQWEQKLETSHLPEMVFGENTLILKHLVSGTKIHFNAFDALSGWKQEALPPVEVPAAAKWKYRT* |
ORF Type | complete |
Blastp | TIP41-like protein from Arabidopsis with 69.09% of identity |
---|---|
Blastx | TIP41-like protein from Arabidopsis with 75.22% of identity |
Eggnog | TIP41, TOR signaling pathway regulator-like (S. cerevisiae)(ENOG410XT96) |
Kegg | Link to kegg annotations (AT4G34270) |
CantataDB | Link to cantataDB annotations (CNT0001789) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452469.1) |
Pfam | TIP41-like family (PF04176.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer