Protein coding transcript 44399

• Transcript: Ll_transcript_376206
• CDS coordinates: 198-914 (+)
• Peptide sequence: MSMKKKGTNSREALEGAVKSIGLGFDLCNALRLRHCKNYSRDSRLISIDDDHVRNLDLPGSLSISNVPKSIKCDKGDRTRLCSDVLSFQQMSEHFNQDLSLSGKIPTGHFNDAFEFSGIWQKDAASTKSLAFDGVSITLYDVALDKTQVVLRDYVKQAVPSSWDPAALARFIEKYGTHVIVGVKIGGTDIVYAKQQYSSPLQPADVQKKLKDMADRFFIDGAGQNNTNDRRFNGKLKV*
• ORF Type: complete

Annotations of Ll_transcript_376206

• Blastp: MACPF domain-containing protein At4g24290 from Arabidopsis with 61.4% of identity
• Blastx: MACPF domain-containing protein At4g24290 from Arabidopsis with 69.51% of identity
• Eggnog: MAC/Perforin domain(ENOG410Y9MJ)
• Kegg: Link to kegg annotations (AT4G24290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416771.1)
• Pfam: MAC/Perforin domain (PF01823.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;