Protein coding transcript 44412

• Transcript: Ll_transcript_376231
• CDS coordinates: 2-772 (+)
• Peptide sequence: KLYCATKSAPTSILSSPVTSPRRTSNVELFDPSLHFHQHFNDILKVSLAKTVPSPDHSPSLSPGSHSLFLNPNTQEGPKQNKFCSRVWPENNHVDAHPLPLPPKASSPIQSCTQHQSSIMHHTTENSPSMKGQWQKGKLIGRGSFGSVYHGTNLETGASCAMKEVDLIPDDPKSADCIKQLEQEIRILRQLKHPNIVQYYGSEVVGDHLYIYMEYVYPGSINKFMHDHCGAMTESMVRNFTWHILSGLAYLHSKKTT
• ORF Type: internal

Annotations of Ll_transcript_376231

• Blastp: Mitogen-activated protein kinase kinase kinase 5 from Arabidopsis with 65.43% of identity
• Blastx: Mitogen-activated protein kinase kinase kinase 5 from Arabidopsis with 65.43% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase(ENOG410XQGS)
• Kegg: Link to kegg annotations (AT5G66850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437995.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;