Protein coding transcript 44441

• Transcript: Ll_transcript_375739
• CDS coordinates: 1298-1651 (+)
• Peptide sequence: MLFNNGRLDTLILESIIKLKEPKGSDRAAITAYIEDQYCSPPNLEKLLSTKLKHMVASGKLVKVSLLLVNAIGARIKLALYKKNYLPKKQHPHLQTSVRKHSGPGLIFGSFVTKIDV*
• ORF Type: complete

Annotations of Ll_transcript_375739

• Blastp: Telomere repeat-binding factor 2 from Arabidopsis with 49.21% of identity
• Blastx: Telomere repeat-binding factor 1 from Arabidopsis with 58.82% of identity
• Eggnog: DNA binding double-stranded telomeric DNA binding protein homodimerization single-stranded telomeric DNA binding transcription factor(ENOG4111CH3)
• Kegg: Link to kegg annotations (AT5G67580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421379.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;