Protein coding transcript 44442

• Transcript: Ll_transcript_375749
• CDS coordinates: 509-991 (+)
• Peptide sequence: MFMNLMIRSIYNYDIRFKKRPSDSRYGLSFDNIALNSEQDKWRNINVTAIWGSRQKAKLALKKNLPAPKIDNNHMALSTVAHRDREVAITEPLSVSGGTSNSKDQISRLQNFHLSISFIYSLEKINGSLCLIGLVLLLSSTWTDIVYYIHYFPCKLQVTS*
• ORF Type: complete

Annotations of Ll_transcript_375749

• Blastp: Telomere repeat-binding factor 2 from Arabidopsis with 53.97% of identity
• Blastx: -
• Eggnog: DNA binding double-stranded telomeric DNA binding protein homodimerization single-stranded telomeric DNA binding transcription factor(ENOG4111CH3)
• Kegg: Link to kegg annotations (AT5G67580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003517350.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;