Protein coding transcript 44453

• Transcript: Ll_transcript_375765
• CDS coordinates: 244-693 (+)
• Peptide sequence: MGAPKQKWTAEEEAALKAGVVKHGAGKWRTILTDPEFSSVLRMRSNVDLKDKWRNINVTAIWGSRQKAKLALKKNLPAPKIDNIHMSSSIVVYHAEEVAVTKTSAASGGTSSTSKEQIPRLDTLILESIIKLKEPKGSDRAAITAYIEV*
• ORF Type: complete

Annotations of Ll_transcript_375765

• Blastp: Telomere repeat-binding factor 2 from Arabidopsis with 55.92% of identity
• Blastx: Telomere repeat-binding factor 2 from Arabidopsis with 55.92% of identity
• Eggnog: DNA binding double-stranded telomeric DNA binding protein homodimerization single-stranded telomeric DNA binding transcription factor(ENOG4111CH3)
• Kegg: Link to kegg annotations (AT5G67580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421379.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;