Transcript | Ll_transcript_375767 |
---|---|
CDS coordinates | 818-1150 (+) |
Peptide sequence | MGAPKQKWTAEEEAALKAGVVKHGAGKWRTILTDPEFSSVLRMRSNVDLKVCFLKGATGFENCSKGSFIIMSGLICYQCTCRMTVYFSHHKKYMQSSLGGKICQTCAMQR* |
ORF Type | complete |
Blastp | Telomere repeat-binding factor 1 from Arabidopsis with 82% of identity |
---|---|
Blastx | Telomere repeat-binding factor 1 from Arabidopsis with 82% of identity |
Eggnog | single myb histone(ENOG4111SQS) |
Kegg | Link to kegg annotations (AT1G49950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421379.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer