Transcript | Ll_transcript_375773 |
---|---|
CDS coordinates | 328-1200 (+) |
Peptide sequence | MGAPKQKWTAEEEAALKAGVVKHGAGKWRTILTDPEFSSVLRMRSNVDLKDKWRNINVTAIWGSRQKAKLALKKSLPAPKLDNNHSSAIVQRDGEVAFTKPLAVSGGSSPKSKEQISRLDTLILESIIKLKEPKGSDRTAIASYIEDQYCSPPNLEKLLSTKLKHMVESGKLMKVKRKYMIPSNLSSSDKRRCSSSLLLEWRSKDSPKIEKTGINNLSKSQIDAELSKIKGMTAQEVAAAAAKAVAEAEAAIAEAEAAARVAEAAEAEAEAAQVFAKAVKRAFKCKKRSP* |
ORF Type | complete |
Blastp | Telomere repeat-binding factor 2 from Arabidopsis with 55.41% of identity |
---|---|
Blastx | Telomere repeat-binding factor 1 from Arabidopsis with 51.88% of identity |
Eggnog | DNA binding double-stranded telomeric DNA binding protein homodimerization single-stranded telomeric DNA binding transcription factor(ENOG4111CH3) |
Kegg | Link to kegg annotations (AT5G67580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424469.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer