Protein coding transcript 44463

• Transcript: Ll_transcript_375782
• CDS coordinates: 970-1842 (+)
• Peptide sequence: MGAPKQKWTAEEEAALKAGVVKHGAGKWRTILTDPEFSSVLRMRSNVDLKDKWRNINVTAIWGSRQKAKLALKKSLPAPKLDNNHSSAIVQRDGEVAFTKPLAVSGGSSPKSKEQISRLDTLILESIIKLKEPKGSDRTAIASYIEDQYCSPPNLEKLLSTKLKHMVESGKLMKVKRKYMIPSNLSSSDKRRCSSSLLLEWRSKDSPKIEKTGINNLSKSQIDAELSKIKGMTAQEVAAAAAKAVAEAEAAIAEAEAAARVAEAAEAEAEAAQVFAKAVKRAFKCKKRSP*
• ORF Type: complete

Annotations of Ll_transcript_375782

• Blastp: Telomere repeat-binding factor 2 from Arabidopsis with 55.41% of identity
• Blastx: Telomere repeat-binding factor 1 from Arabidopsis with 51.88% of identity
• Eggnog: DNA binding double-stranded telomeric DNA binding protein homodimerization single-stranded telomeric DNA binding transcription factor(ENOG4111CH3)
• Kegg: Link to kegg annotations (AT5G67580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424469.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;