Transcript | Ll_transcript_375828 |
---|---|
CDS coordinates | 83-979 (+) |
Peptide sequence | MKRQENKMEKAIQRQKVLLQHLQPISSTSSFSSQPTTHLSASTCAAGNFSEDDVVVVAAYRTPLCKAKRGGFKDTYPDDLLATVLKAVIDKTNLDPSEVGDIIVGTVLGPGSERAIECKMAAFYAGFPATVPLRTVNRQCSSGLQAVADVAAYIKSGAYDIGIGAGLEYMSQLNTLSFGKVNPKAKLFPQAGDCLLPMGVTSENVAARFGLTRLEQDQAAVESHRRAAAATAAGKFKDEIVPVHTRFVDPKTGEEKQIIVSVDDGIRPQTTLASLAKLKPVFKADGSTTAGNQNSYVH* |
ORF Type | complete |
Blastp | 3-ketoacyl-CoA thiolase 2, peroxisomal from Arabidopsis with 71.86% of identity |
---|---|
Blastx | 3-ketoacyl-CoA thiolase 2, peroxisomal from Arabidopsis with 71.53% of identity |
Eggnog | acetyl-coa acetyltransferase(COG0183) |
Kegg | Link to kegg annotations (AT2G33150) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463412.1) |
Pfam | Thiolase, N-terminal domain (PF00108.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer