Protein coding transcript 445

• Transcript: Ll_transcript_317651
• CDS coordinates: 1-561 (+)
• Peptide sequence: QKLHDVLLESGVVAPPHLFSEIYHRELGSPTEANFPTEEKDEHKHGSGQKESQVDNNLGTTQFLSPLPHYLLHPKATPCCQSEHSKPVDSLGIEYPLDTTVADGQKIPSWAKYGENVPVAAVAAAAAAVVASSMVVAAAKSGNDSNIELPVVAAATATAVAVVASTAAATRLYEQGSRSDGDTDGSG
• ORF Type: internal

Annotations of Ll_transcript_317651

• Blastp: Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 42.55% of identity
• Blastx: Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 51.43% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G73660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436719.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;