Transcript | Ll_transcript_376531 |
---|---|
CDS coordinates | 1810-2241 (+) |
Peptide sequence | MEKGKGVMVGSVGRRWGIDLSDNSTSPSSRDFLDPPGFSRASLDHDDSSLTRPTKDAESTWKSQKAWEVAQAPFKNLLMMGFMMWMAGSTVHLFSIGITFSALWQPISALQSLGKSNNLNLFNLFNSFLNFLFIPSSSSSFSF* |
ORF Type | complete |
Blastp | ER membrane protein complex subunit 4 from Danio with 32.38% of identity |
---|---|
Blastx | Peroxidase 18 from Arabidopsis with 70.45% of identity |
Eggnog | ER membrane protein complex subunit 4(ENOG41118KQ) |
Kegg | Link to kegg annotations (402956) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016162825.1) |
Pfam | Protein of unknown function (DUF1077) (PF06417.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer