Protein coding transcript 44570

• Transcript: Ll_transcript_376525
• CDS coordinates: 415-963 (+)
• Peptide sequence: MEKGKGVMVGSVGRRWGIDLSDNSTSPSSRDFLDPPGFSRASLDHDDSSLTRPTKDAESTWKSQKAWEVAQAPFKNLLMMGFMMWMAGSTVHLFSIGITFSALWQPISALQSLGKIFEPYKDTKVELLGPKLLFIALNLGGLALGVWKLNAMGLLPTHTSDWVSSLPPALEVEYSGGGINLG*
• ORF Type: complete

Annotations of Ll_transcript_376525

• Blastp: ER membrane protein complex subunit 4 from Danio with 33.92% of identity
• Blastx: ER membrane protein complex subunit 4 from Danio with 33.92% of identity
• Eggnog: ER membrane protein complex subunit 4(ENOG41118KQ)
• Kegg: Link to kegg annotations (402956)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016162825.1)
• Pfam: Protein of unknown function (DUF1077) (PF06417.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;