Transcript | Ll_transcript_374979 |
---|---|
CDS coordinates | 371-1051 (+) |
Peptide sequence | MATAPQKTTPIPDWNLDHAPKNLSLPLTQQQSSINAPPPSLPQGVTALTRPQSSHPLDPLSAAEITVAVATVRAAGATPELRDSMRFIEVVLLEPDKNVVALADAYFFPPFQPSLLSRTKGGPVIPSKLPPRCARLVVYNKKTNETSIWVVELSEVHAVTRGGHHRGKVISSHVVPDVQPPMDAVEYAECEAVVKDFPPFREAMKKRGIENMDLVMVDPWCAGYFSE |
ORF Type | 3prime_partial |
Blastp | Copper methylamine oxidase from Arthrobacter with 32.57% of identity |
---|---|
Blastx | Copper methylamine oxidase from Arthrobacter with 32% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463898.1) |
Pfam | Copper amine oxidase, N2 domain (PF02727.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer