Protein coding transcript 44606

• Transcript: Ll_transcript_374983
• CDS coordinates: 424-1506 (+)
• Peptide sequence: MDAVEYAECEAAVKSYPPFIEAMKKRGIENMDLVMVDPWCAGYFSEADNPNRRLAKPIIFCKCESDCPMENGYARPVEGIFVLVDMQNMEVIQFEDRKLVPLPPVDPLRNYTHGATRGGSDRSDLKPLKIVQPEGPSFSVNGYYVEWQKWNFRIGFTPKEGLVIYSVAYADGSQGLRPVAHRLSFVEMVVPYGDPNDPHYRKNAFDAGEDGLGRNAHSLKKGCDCAGLVKYFDAHFTNFTGGVETIENCVCLHEEDHGILWKHKDWRTGLSEVRRSRRLTVSFICTVANYEYGFFWHFYQDGKMEAEVKLTGILSMGALMPGEYRKYGTMIAPGLYAPVHQHFFVARMNMAVDSKPGEAFN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_374983

• Blastp: Copper methylamine oxidase from Arthrobacter with 49.01% of identity
• Blastx: Copper methylamine oxidase from Arthrobacter with 48.22% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417507.1)
• Pfam: Copper amine oxidase, N3 domain (PF02728.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;