Protein coding transcript 44645

• Transcript: Ll_transcript_374819
• CDS coordinates: 2-406 (+)
• Peptide sequence: HDFAFVEFSDPRDADDARYHLDGRDFDGSRLIVEFAKGVPRGSQAPRGSREYLGRGPAPGSGRCFNCGLDGHWARDCKAGDWKNKCYRCGERGHIEKNCKNSPKKLRYPLFCSLSNRCCIVHIFLKILILLMLS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_374819

• Blastp: Serine/arginine-rich splicing factor RS2Z33 from Arabidopsis with 77.57% of identity
• Blastx: Serine/arginine-rich splicing factor RS2Z33 from Arabidopsis with 77.57% of identity
• Eggnog: serine arginine-rich splicing factor(ENOG4111N8Y)
• Kegg: Link to kegg annotations (AT2G37340)
• CantataDB: Link to cantataDB annotations (CNT0001557)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456367.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;