Protein coding transcript 44661

• Transcript: Ll_transcript_374842
• CDS coordinates: 147-809 (+)
• Peptide sequence: MQLLAVTCLSLAAKFDETKVPTPLDLQVGESEFVFEAKIIQRMELMVLNTLKWRMQSITPFSFIDYFLCKVNDDQSQIRSSILRSIQLILSTIRGIDFLEFKPSEIAAAVALYVVGETKTVHTEKAISVLIPLVEKERVLKCVKMLQELSSNNVYAEHTSGGSVPVPVPVPCVPQSPIGVLDAICFSYKSDDTNKSDDSKGGSCASSPHDSPSAKRRKLK*
• ORF Type: complete

Annotations of Ll_transcript_374842

• Blastp: Cyclin-D3-1 from Oryza sativa with 48.64% of identity
• Blastx: Cyclin-D4-1 from Arabidopsis with 48.51% of identity
• Eggnog: (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1) S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin(ENOG410XRKC)
• Kegg: Link to kegg annotations (4340499)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431100.1)
• Pfam: Cyclin, N-terminal domain (PF00134.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;