Protein coding transcript 44677

• Transcript: Ll_transcript_375354
• CDS coordinates: 128-739 (+)
• Peptide sequence: MQKYRLGQHTRKQNEEQHKENRCSYVNFSSCSSGPNTSYRGDNERGEIPIAKALRHQIEVQKRLEEQLEVQRKLQMRIEAQGMYLQAVLEKSQRSFSMDVPDRLEASRAKLNEFNSALSNFMENVNKDCKENLVGMNDLYRKGHGSSSFQIYQGGIEENKDQKPKVEEGTIQLDLNMKGSYDLVSAGGAELETKMLSDSVNKF*
• ORF Type: complete

Annotations of Ll_transcript_375354

• Blastp: Myb family transcription factor PHL11 from Arabidopsis with 41.04% of identity
• Blastx: Myb family transcription factor PHL11 from Arabidopsis with 40.54% of identity
• Eggnog: Myb-like DNA-binding domain(ENOG410YGU0)
• Kegg: Link to kegg annotations (AT5G45580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445245.1)
• Pfam: MYB-CC type transfactor, LHEQLE motif (PF14379.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;