Transcript | Ll_transcript_375361 |
---|---|
CDS coordinates | 842-1228 (+) |
Peptide sequence | MRIEAQGMYLQAVLEKSQRSFSMDVPDRLEASRAKLNEFNSALSNFMENVNKDCKENLVGMNDLYRKGHGSSSFQIYQGGIEENKDQKPKVEEGTIQLDLNMKGSYDLVSAGGAELETKMLSDSVNKF* |
ORF Type | complete |
Blastp | Myb family transcription factor PHL11 from Arabidopsis with 33.85% of identity |
---|---|
Blastx | Myb family transcription factor PHL11 from Arabidopsis with 65.38% of identity |
Eggnog | Myb-like DNA-binding domain(ENOG410YGU0) |
Kegg | Link to kegg annotations (AT5G45580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445244.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer