Protein coding transcript 44710

• Transcript: Ll_transcript_374947
• CDS coordinates: 1-954 (+)
• Peptide sequence: KQLIVGVNKMDSTEPPFSEARFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSAKMGWYKGWAVERKEGKADGKCLIEALDAILPPSRPTDKALRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVTFAPANITTEVKSVEMHHEALVEAVPGDNVGFNIKNVSVKELRRGYVAGDSKANPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFSEIKQKCDRRTGKTTEENPKAIKSGDAAIVILVPSKPMCVESFQEFPPLGRFAVRDMRQTVAVGVIKQVTFKEATSGKVTKAAEKAQKKK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_374947

• Blastp: Elongation factor 1-alpha from Bombyx with 90.54% of identity
• Blastx: Elongation factor 1-alpha 2 from Sophophora with 90.13% of identity
• Eggnog: This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis (By similarity)(COG5256)
• Kegg: Link to kegg annotations (693059)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020966330.1)
• Pfam: Elongation factor Tu domain 2 (PF03144.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;