Transcript | Ll_transcript_374948 |
---|---|
CDS coordinates | 1-954 (+) |
Peptide sequence | KQLIVGVNKMDSTEPPFSEARFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSAKMGWYKGWAVERKEGKADGKCLIEALDAILPPSRPTDKALRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVTFAPANITTEVKSVEMHHEALVEAVPGDNVGFNIKNVSVKELRRGYVAGDSKANPPKGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIACKFSEIKEKCDRRTGKTTEENPKAIKSGDAAIVILVPSKPMCVESFQEFPPLGRFAVRDMRQTVAVGVIKSVNFKDASSGKVTKAAEKAQKKK* |
ORF Type | 5prime_partial |
Blastp | Elongation factor 1-alpha 1 from Sophophora with 90.85% of identity |
---|---|
Blastx | Elongation factor 1-alpha 2 from Sophophora with 90.46% of identity |
Eggnog | This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis (By similarity)(COG5256) |
Kegg | Link to kegg annotations (Dmel_CG8280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013469495.1) |
Pfam | Elongation factor Tu domain 2 (PF03144.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer