Protein coding transcript 44732

• Transcript: Ll_transcript_374066
• CDS coordinates: 153-1313 (+)
• Peptide sequence: MGESEVIHSWSAPRSLSTSLMYSFAQRDDVEVLDEPLYAHFLRVTGVDRPYREEVLSKMERDGNKVVNDIIFAPGRKKYRFCKHMSKQRLQGLTDDLMKKGKHFILIRNPLDILPSFDKVVPPSFFEMGLAELVSIYNELRELGKPPPVIDAAELQQDPEATLRGLCDDLEIPFQPAMLNWEAGAKSIDGVWAPWWYSSVHKSTCFEEAKKYPQPFPFSHYDLLEQSLPLYNMLRRHVKRKSSLLSSPLPPPNLPVPANEKLLAWVGDEIVPRDSAKVSVFDSVVQGGDSVWEGLRVYNGKVFKLEEHLDRLFDSAKALAFENVPTRDEIKEAIFKTLIRNGMFDNSHIRLSLTRGKKVTSGMSPAFNLYGCTLIGNFISLHGCTK*
• ORF Type: complete

Annotations of Ll_transcript_374066

• Blastp: Branched-chain-amino-acid aminotransferase-like protein 2 from Arabidopsis with 78.44% of identity
• Blastx: Branched-chain-amino-acid aminotransferase-like protein 2 from Arabidopsis with 78.44% of identity
• Eggnog: brancheD-chain amino acid aminotransferase(COG0115)
• Kegg: Link to kegg annotations (AT5G27410)
• CantataDB: Link to cantataDB annotations (CNT0001957)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419836.1)
• Pfam: Amino-transferase class IV (PF01063.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;