Protein coding transcript 44736

• Transcript: Ll_transcript_374085
• CDS coordinates: 988-1740 (+)
• Peptide sequence: MIASGNHERDWPNSGSFFDTPDSGGECGVLAETMYYFPAENRAKFWYKADYGMFRFCIADSEHDWREGSEQYKFIEHCLATVDRKHQPWLIFSAHRPLAYSSNSWYGKEGSFEEPEGREHLQKLWQKYKVDIAFYGHVHNYERVCPIYQNQCVNSEKTHYSGTVNGTIHIVVGGGGSHLSDYTPSPPVWSLFRDRDFGFGKLTAFNHSYLLFEYKKSSDGNVYDFFTISRDYRDVLACVHDGCEKTTLAS*
• ORF Type: complete

Annotations of Ll_transcript_374085

• Blastp: Nucleotide pyrophosphatase/phosphodiesterase from Hordeum with 78.8% of identity
• Blastx: Nucleotide pyrophosphatase/phosphodiesterase from Hordeum with 79.68% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417626.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;