Protein coding transcript 448

• Transcript: Ll_transcript_333699
• CDS coordinates: 3-371 (+)
• Peptide sequence: LAVLRSQMIRKKVVESTKECIKQQRTKSEMYGKIEAVFIEMDTDPTDKELQTLKKAVMESDNKDGEKENFDPEKNIEEYLPVRVNEQRVSNFLQSLMIGVAILGISVIKLIPTSVLWGYFAYM
• ORF Type: internal

Annotations of Ll_transcript_333699

• Blastp: Probable boron transporter 7 from Arabidopsis with 55.04% of identity
• Blastx: Probable boron transporter 7 from Arabidopsis with 55.04% of identity
• Eggnog: solute carrier family 4(ENOG410XPHD)
• Kegg: Link to kegg annotations (AT4G32510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437703.1)
• Pfam: HCO3- transporter family (PF00955.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;