Protein coding transcript 44804

• Transcript: Ll_transcript_375786
• CDS coordinates: 28-1125 (+)
• Peptide sequence: MSSNLCTTLFDRSKGEYLCEGVIDEVVNGRFPSWVRRKDRRLLECSVGEIEANVVVAKDGSGEFETVAEAVATVPDKSMRRYVIYVKNGTYNENVEINSKKKNVMLVGDGMNATIITGSLNNVDGTSTFRSATLAAVGDGFIAQDMWFQNTAGPEKHQAVALRVGADQSIINRCRIDAYQDTLYAHSNRQFYRDSFITGTVDFIFGNAGVVFQNCNLQARKPMDNQNNMVTAQGRDDPNQNTGTSIQQCQLTPSPDLEPVLGSIKTYLGRPWKNFSRTVVMESSIEKHIDPAGWAEWDAEHKDYLETLYYAEYMNNGPGAGVGRRVNWSGFHIIGAEEADNFTVKELIQGDVWLKNTGVTFIEGL*
• ORF Type: complete

Annotations of Ll_transcript_375786

• Blastp: Pectinesterase 2.1 from Lycopersicon with 66.86% of identity
• Blastx: Pectinesterase 2.1 from Lycopersicon with 66.86% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (544289)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422238.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;