Protein coding transcript 44810

• Transcript: Ll_transcript_374211
• CDS coordinates: 85-831 (+)
• Peptide sequence: MVEKTKYRKGLWSPEEDNKLRNHILMFGHSCWSSVPIKAGLLRNGKSCRLRWINYLRPGLKRGVFSKQEEETIMSFHNMLGNKWSQIAHHLPGRTDNEIKNFWHSYLKKKANKAKEIESHKQLHYGTSSSDTIDYSLSPQKLATQEAGYGLLENIDKSASHSDNSYPQNHNFSKEACYSSLPKVLFAEWLSLDHVNGGSSINSDESLLGNGFDQNSSFQETLMQISEGPFGGEYHNSIITSSTTEVYNS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_374211

• Blastp: Transcription factor LAF1 from Arabidopsis with 54.04% of identity
• Blastx: Transcription factor LAF1 from Arabidopsis with 54.5% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT4G25560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465259.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;