Transcript | Ll_transcript_374026 |
---|---|
CDS coordinates | 2-1006 (+) |
Peptide sequence | FIFHSHPSLFFFSSNFITKMKIQTSSIFFLLTVLTTVSLADKLTSATFNGAIYSDRTRNDKKQRLSPISFKNNNTPIATAATGTDCEVWSKECSEAVLSMARRPEMVEWIRKIRRRIHENPELAFEEIETSGLIRKELDMMKISYRYPVAKTGIRAWIGTGGPPFVAIRADMDALPIEEAVELEYKSKVAGKMHACGHDAHVAMLMGAAKILKTREHLLKGTVILLFQPGEEAGNGAKKMIEDGALENVEAIFGVHVFHHLETSIIGSRPGSFLAGCGIFRALISGKKGTATNPVLAASAAIISLQGIVSRESDPLDTQVLVPICVSLFCFLVL* |
ORF Type | 5prime_partial |
Blastp | IAA-amino acid hydrolase ILR1-like 6 from Arabidopsis with 67.05% of identity |
---|---|
Blastx | IAA-amino acid hydrolase ILR1-like 6 from Arabidopsis with 67.05% of identity |
Eggnog | amidohydrolase(COG1473) |
Kegg | Link to kegg annotations (AT1G44350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438581.1) |
Pfam | Peptidase family M20/M25/M40 (PF01546.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer