Protein coding transcript 45082

• Transcript: Ll_transcript_376371
• CDS coordinates: 3-302 (+)
• Peptide sequence: SPRVASIVMTAAAKNLTPVTLELGGKCPAILDHLSNPSDFKIELLKKIISKFYGDNPIQSKVISRIVNKQNFERLCNLLKDPLVEACIVHGGSVDEENL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_376371

• Blastp: Aldehyde dehydrogenase family 3 member F1 from Arabidopsis with 40.3% of identity
• Blastx: Aldehyde dehydrogenase family 3 member F1 from Arabidopsis with 40.3% of identity
• Eggnog: Dehydrogenase(COG1012)
• Kegg: Link to kegg annotations (AT4G36250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446870.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;