Protein coding transcript 45124

• Transcript: Ll_transcript_376709
• CDS coordinates: 1-771 (+)
• Peptide sequence: RRHYFLVCVPFSSLSLFITLSFESLSVNFFNGIAFFYNHSRSILQLLLFLFHFHFLLLLSLSLHATLACTLPHLNIHTSELETTMPITFFSFSKFLSFSFIFSLFLPLSLSNTDSADVQALGVLYNALNSPTVLTGWKIGDGDPCGESWKGITCDGSSVVSIELSGLGLNGTLGYLLSDLMSLRKLDLSDNKIHDTIPYQLPPNLTSLNFARNNLSGNLPYSISAMTSLNYLNVSNNVLSMTIGDMFQTLSDLNTL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_376709

• Blastp: Protein STRUBBELIG-RECEPTOR FAMILY 8 from Arabidopsis with 73.61% of identity
• Blastx: Protein STRUBBELIG-RECEPTOR FAMILY 8 from Arabidopsis with 73.61% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G22130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439840.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;