Transcript | Ll_transcript_376709 |
---|---|
CDS coordinates | 1-771 (+) |
Peptide sequence | RRHYFLVCVPFSSLSLFITLSFESLSVNFFNGIAFFYNHSRSILQLLLFLFHFHFLLLLSLSLHATLACTLPHLNIHTSELETTMPITFFSFSKFLSFSFIFSLFLPLSLSNTDSADVQALGVLYNALNSPTVLTGWKIGDGDPCGESWKGITCDGSSVVSIELSGLGLNGTLGYLLSDLMSLRKLDLSDNKIHDTIPYQLPPNLTSLNFARNNLSGNLPYSISAMTSLNYLNVSNNVLSMTIGDMFQTLSDLNTL* |
ORF Type | 5prime_partial |
Blastp | Protein STRUBBELIG-RECEPTOR FAMILY 8 from Arabidopsis with 73.61% of identity |
---|---|
Blastx | Protein STRUBBELIG-RECEPTOR FAMILY 8 from Arabidopsis with 73.61% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G22130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439840.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer