Transcript | Ll_transcript_374663 |
---|---|
CDS coordinates | 1-513 (+) |
Peptide sequence | GSHSVDGNWRALGKLLIYCSGWKKGGLFNTDHVPGHFVDQTRFSRTSGKSFLLPQCRTDVLYVSDPCEHLDQGEEGDVGFFRGFFKSFATSKVRKMLINKGAKLHPTELCPYCKAKLWSMLQAKMIPQSASCRLGSYEDRVEYFVCLNGHMVGICTLLPLSDSEEASELQ* |
ORF Type | 5prime_partial |
Blastp | EID1-like F-box protein 2 from Arabidopsis with 80.7% of identity |
---|---|
Blastx | EID1-like F-box protein 2 from Arabidopsis with 80.7% of identity |
Eggnog | EID1-like F-box protein(ENOG4111HQB) |
Kegg | Link to kegg annotations (AT5G39360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448213.1) |
Pfam | - |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer