| Transcript | Ll_transcript_374664 |
|---|---|
| CDS coordinates | 1-513 (+) |
| Peptide sequence | GSHSVDGNWRALGKLLIYCSGWKKGGLFNTDHVPGHFVDQTRFSRTSGKSFLLPQCRTDVLYVSDPCEHLDQGEEGDVGFFRGFFKSFATSKVRKMLINKGAKLHPTELCPYCKAKLWSMLQAKMIPQSASCRLGSYEDRVEYFVCLNGHMVGICTLLPLSDSEEASELQ* |
| ORF Type | 5prime_partial |
| Blastp | EID1-like F-box protein 2 from Arabidopsis with 80.7% of identity |
|---|---|
| Blastx | EID1-like F-box protein 2 from Arabidopsis with 80.7% of identity |
| Eggnog | EID1-like F-box protein(ENOG4111HQB) |
| Kegg | Link to kegg annotations (AT5G39360) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019448213.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer