Protein coding transcript 45209

• Transcript: Ll_transcript_376634
• CDS coordinates: 2280-2585 (+)
• Peptide sequence: MSDAKFDGADMSEVVMSKAYAVGASFKGVDFSNAVLDRVNFGKADLQGAVFKNTVLSGSTFDDAKLEGVDFEDTIIGYVDLQKLCVNKTINDETRALLGCR*
• ORF Type: complete

Annotations of Ll_transcript_376634

• Blastp: Thylakoid lumenal 17.4 kDa protein, chloroplastic from Arabidopsis with 75.25% of identity
• Blastx: Thylakoid lumenal 17.4 kDa protein, chloroplastic from Arabidopsis with 78.98% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G53490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417866.1)
• Pfam: Pentapeptide repeats (8 copies) (PF00805.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;