| Transcript | Ll_transcript_374456 |
|---|---|
| CDS coordinates | 436-897 (+) |
| Peptide sequence | MYEACGRIVNPVFGALGLLWSGEWAQCQAAVDAVLNGSEISALELSDWQVTPGSKHVFPAHDIRHVSRDSQVNQLRGERPRFKRTGNVIRPIARVGSIDSAGLWNLGSGSSEEQGNKESWETESDETVEAMLMSQDEPSRTGEAEVCLELTLG* |
| ORF Type | complete |
| Blastp | LOB domain-containing protein 42 from Arabidopsis with 36.57% of identity |
|---|---|
| Blastx | LOB domain-containing protein 42 from Arabidopsis with 36.96% of identity |
| Eggnog | lob domain-containing protein(ENOG411150B) |
| Kegg | Link to kegg annotations (AT1G68510) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019430119.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer