Protein coding transcript 45276

• Transcript: Ll_transcript_374466
• CDS coordinates: 173-841 (+)
• Peptide sequence: MRLSCNGCRILRKGCSDDCIIRPCLEWIKSPESQANATLFLAKFYGRAGLINLINAAPQPLRPGVFKSLMYEACGRIVNPVFGALGLLWSGEWAQCQAAVDAVLNGSEISALELSDWQVTPGSKHVFPAHDIRHVSRDSQVNQLRGERPRFKRTGNVIRPIARVGSIDSAGLWNLGSGSSEEQGNKESWETESDETVEAMLMSQDEPSRTGEAEVCLELTLG*
• ORF Type: complete

Annotations of Ll_transcript_374466

• Blastp: LOB domain-containing protein 41 from Arabidopsis with 48.47% of identity
• Blastx: LOB domain-containing protein 41 from Arabidopsis with 48.47% of identity
• Eggnog: lob domain-containing protein(ENOG410YBK4)
• Kegg: Link to kegg annotations (AT3G02550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430119.1)
• Pfam: Lateral organ boundaries (LOB) domain (PF03195.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;