Protein coding transcript 45304

• Transcript: Ll_transcript_374493
• CDS coordinates: 817-1500 (+)
• Peptide sequence: MQKGSLENHLFRKGVQPIAWATRISIAIGVARGLAFLHSLNANVIFRDLKASNILLDSDFNAKLSDFGLARDGPTGDNTHVSTRVIGTQGYAAPEYVATGHLTPRSDVYSFGVVLLELLTGRRALEDNGPGFSDETLVDWAKPFLSDSRRVLRIMDTRLGGQYSKKGAQAAAALALQCLGTDPKFRPPMVDVLAALEGLNSSNTMPPPTQKSGTEIRAAKHSGHSHN*
• ORF Type: complete

Annotations of Ll_transcript_374493

• Blastp: Probable serine/threonine-protein kinase PBL2 from Arabidopsis with 68.16% of identity
• Blastx: Probable serine/threonine-protein kinase PBL2 from Arabidopsis with 65.37% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G14370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440606.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;