Transcript | Ll_transcript_375552 |
---|---|
CDS coordinates | 997-1533 (+) |
Peptide sequence | MDLFPTKENNLTTMDLLSPHIAYNSHSTKEVPTLVNPSAFKSVGKEPKTSQLTIFYGGQVIVYDDFPAEKAEEIMSFARKGISQNQNTSVYAHNQPSMIPSIIPANLIPEHPHHAPPTTPIVCDLPIARKASLHRFLEKRKDRIAAKAPYKTSNAMAAPNKPADESIAWLGLAAKSTL* |
ORF Type | complete |
Blastp | Protein TIFY 10a from Oryza sativa with 44.83% of identity |
---|---|
Blastx | Protein TIFY 10b from Oryza sativa with 38.89% of identity |
Eggnog | jasmonate ZIM domain-containing protein(ENOG410ZDCD) |
Kegg | Link to kegg annotations (4333065) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443429.1) |
Pfam | tify domain (PF06200.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer